PDB entry 2z3m

View 2z3m on RCSB PDB site
Description: complex structure of LF-transferase and dAF
Class: transferase
Keywords: LF-transferase
Deposited on 2007-06-04, released 2007-10-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.22
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leucyl/phenylalanyl-tRNA-protein transferase
    Species: Escherichia coli [TaxId:562]
    Gene: aat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2z3ma_
  • Chain 'B':
    Compound: Leucyl/phenylalanyl-tRNA-protein transferase
    Species: Escherichia coli [TaxId:562]
    Gene: aat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2z3mb_
  • Heterogens: 3D1, PHE, TAR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z3mA (A:)
    rlvqlsrhsiafpspegalrepngllalggdlsparllmayqrgifpwfspgdpilwwsp
    dpravlwpeslhisrsmkrfhkrspyrvtmnyafgqviegcasdreegtwitrgvveayh
    rlhelghahsievwredelvggmygvaqgtlfcgesmfsrmenasktallvfceefighg
    gklidcqvlndhtaslgaceiprrdylnylnqmrlgrlpnnfwvprclfspqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z3mA (A:)
    rlvqlsrhsiafpspegalrepngllalggdlsparllmayqrgifpwfspgdpilwwsp
    dpravlwpeslhisrsmkrfhkrspyrvtmnyafgqviegcasdreegtwitrgvveayh
    rlhelghahsievwredelvggmygvaqgtlfcgesmfsrmenasktallvfceefighg
    gklidcqvlndhtaslgaceiprrdylnylnqmrlgrlpnnfwvprclfsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z3mB (B:)
    rlvqlsrhsiafpspegalrepngllalggdlsparllmayqrgifpwfspgdpilwwsp
    dpravlwpeslhisrsmkrfhkrspyrvtmnyafgqviegcasdreegtwitrgvveayh
    rlhelghahsievwredelvggmygvaqgtlfcgesmfsrmenasktallvfceefighg
    gklidcqvlndhtaslgaceiprrdylnylnqmrlgrlpnnfwvprclfspqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z3mB (B:)
    rlvqlsrhsiafpspegalrepngllalggdlsparllmayqrgifpwfspgdpilwwsp
    dpravlwpeslhisrsmkrfhkrspyrvtmnyafgqviegcasdreegtwitrgvveayh
    rlhelghahsievwredelvggmygvaqgtlfcgesmfsrmenasktallvfceefighg
    gklidcqvlndhtaslgaceiprrdylnylnqmrlgrlpnnfwvprclfsp