| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) ![]() |
| Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (3 proteins) lacks the first helix of canonical fold 3 helices; bundle, partly opened, right-handed twist |
| Protein Purine repressor (PurR), N-terminal domain [47439] (1 species) |
| Species Escherichia coli [TaxId:562] [47440] (24 PDB entries) |
| Domain d1qp7a1: 1qp7 A:3-58 [17103] Other proteins in same PDB: d1qp7a2 protein/DNA complex; complexed with hpa; mutant |
PDB Entry: 1qp7 (more details), 2.9 Å
SCOP Domain Sequences for d1qp7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qp7a1 a.35.1.5 (A:3-58) Purine repressor (PurR), N-terminal domain {Escherichia coli}
tikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslavnh
Timeline for d1qp7a1: