Lineage for d1qp7a1 (1qp7 A:3-58)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 280586Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 280587Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 280688Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (3 proteins)
    lacks the first helix of canonical fold
    3 helices; bundle, partly opened, right-handed twist
  6. 280711Protein Purine repressor (PurR), N-terminal domain [47439] (1 species)
  7. 280712Species Escherichia coli [TaxId:562] [47440] (24 PDB entries)
  8. 280734Domain d1qp7a1: 1qp7 A:3-58 [17103]
    Other proteins in same PDB: d1qp7a2
    protein/DNA complex; complexed with hpa; mutant

Details for d1qp7a1

PDB Entry: 1qp7 (more details), 2.9 Å

PDB Description: purine repressor mutant-hypoxanthine-palindromic operator complex

SCOP Domain Sequences for d1qp7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qp7a1 a.35.1.5 (A:3-58) Purine repressor (PurR), N-terminal domain {Escherichia coli}
tikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslavnh

SCOP Domain Coordinates for d1qp7a1:

Click to download the PDB-style file with coordinates for d1qp7a1.
(The format of our PDB-style files is described here.)

Timeline for d1qp7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qp7a2