Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (10 species) not a true protein |
Species Thermus thermophilus [TaxId:262724] [188269] (2 PDB entries) |
Domain d2z11a_: 2z11 A: [170966] automated match to d1yrea1 |
PDB Entry: 2z11 (more details), 2.15 Å
SCOPe Domain Sequences for d2z11a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z11a_ d.108.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 262724]} mwafperfegrhvrleplalahlpaflrhydpevyrflsrapvapteealrahlegllge pgrvnwailfgkevagrisviapepehaklelgtmlfkpfwgspankeakylllrhafev lraervqfkvdlrnersqralealgavregvlrknrrlpdgafrddvvysvlkeewpgvk arlearly
Timeline for d2z11a_: