Lineage for d2z11a_ (2z11 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1037211Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1037212Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1037712Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 1037713Protein automated matches [190038] (8 species)
    not a true protein
  7. 1037732Species Thermus thermophilus [TaxId:262724] [188269] (2 PDB entries)
  8. 1037734Domain d2z11a_: 2z11 A: [170966]
    automated match to d1yrea1

Details for d2z11a_

PDB Entry: 2z11 (more details), 2.15 Å

PDB Description: Crystal structure of putative acetyltransferase
PDB Compounds: (A:) Ribosomal-protein-alanine acetyltransferase

SCOPe Domain Sequences for d2z11a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z11a_ d.108.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 262724]}
mwafperfegrhvrleplalahlpaflrhydpevyrflsrapvapteealrahlegllge
pgrvnwailfgkevagrisviapepehaklelgtmlfkpfwgspankeakylllrhafev
lraervqfkvdlrnersqralealgavregvlrknrrlpdgafrddvvysvlkeewpgvk
arlearly

SCOPe Domain Coordinates for d2z11a_:

Click to download the PDB-style file with coordinates for d2z11a_.
(The format of our PDB-style files is described here.)

Timeline for d2z11a_: