Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
Protein PII (product of glnB) [54915] (8 species) trimer with orthogonal packing of beta-sheets around the threefold axis |
Species Aquifex aeolicus [TaxId:63363] [188357] (3 PDB entries) |
Domain d2z0gc_: 2z0g C: [170954] automated match to d1pila_ complexed with cl, po4 |
PDB Entry: 2z0g (more details), 2.1 Å
SCOPe Domain Sequences for d2z0gc_:
Sequence, based on SEQRES records: (download)
>d2z0gc_ d.58.5.1 (C:) PII (product of glnB) {Aquifex aeolicus [TaxId: 63363]} mkkieaiikpfkldevkdalveigiggmtvtevkgfgqqkghteiyrgteyvidflpkvk ievvvrdedvekvvetivktaqtgrvgdgkifiipvedvirirtgergeqai
>d2z0gc_ d.58.5.1 (C:) PII (product of glnB) {Aquifex aeolicus [TaxId: 63363]} mkkieaiikpfkldevkdalveigiggmtvtevkgfdflpkvkievvvrdedvekvveti vktaqtgrvgdgkifiipvedvirirtgergeqai
Timeline for d2z0gc_: