Lineage for d2z0gb_ (2z0g B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950564Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. 2950570Protein PII (product of glnB) [54915] (8 species)
    trimer with orthogonal packing of beta-sheets around the threefold axis
  7. 2950571Species Aquifex aeolicus [TaxId:63363] [188357] (3 PDB entries)
  8. 2950575Domain d2z0gb_: 2z0g B: [170953]
    automated match to d1pila_
    complexed with cl, po4

Details for d2z0gb_

PDB Entry: 2z0g (more details), 2.1 Å

PDB Description: The crystal structure of PII protein
PDB Compounds: (B:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d2z0gb_:

Sequence, based on SEQRES records: (download)

>d2z0gb_ d.58.5.1 (B:) PII (product of glnB) {Aquifex aeolicus [TaxId: 63363]}
mkkieaiikpfkldevkdalveigiggmtvtevkgfgqqkghteiyrgteyvidflpkvk
ievvvrdedvekvvetivktaqtgrvgdgkifiipvedvirirtgergeqai

Sequence, based on observed residues (ATOM records): (download)

>d2z0gb_ d.58.5.1 (B:) PII (product of glnB) {Aquifex aeolicus [TaxId: 63363]}
mkkieaiikpfkldevkdalveigiggmtvtevkgfdflpkvkievvvrdedvekvveti
vktaqtgrvgdgkifiipvedvirirtgergeqai

SCOPe Domain Coordinates for d2z0gb_:

Click to download the PDB-style file with coordinates for d2z0gb_.
(The format of our PDB-style files is described here.)

Timeline for d2z0gb_: