Lineage for d2yyub_ (2yyu B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2826771Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 2826917Protein automated matches [190130] (11 species)
    not a true protein
  7. 2826937Species Geobacillus kaustophilus [TaxId:235909] [188260] (2 PDB entries)
  8. 2826939Domain d2yyub_: 2yyu B: [170936]
    automated match to d1dbta_
    complexed with c5p

Details for d2yyub_

PDB Entry: 2yyu (more details), 2.2 Å

PDB Description: Crystal structure of uncharacterized conserved protein from Geobacillus kaustophilus
PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d2yyub_:

Sequence, based on SEQRES records: (download)

>d2yyub_ c.1.2.3 (B:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
htpfivaldfpskqeverflrpfagtplfvkvgmelyyqegpaivaflkeqghavfldlk
lhdipntvkqamkglarvgadlvnvhaaggrrmmeaaiegldagtpsgrmrprciavtql
tstdermlheelwisrplvetvahyaalakesgldgvvcsaneaafikercgasflavtp
girfaddaahdqvrvvtprkaralgsdyivigrsltraadplrtyarlqhewn

Sequence, based on observed residues (ATOM records): (download)

>d2yyub_ c.1.2.3 (B:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
htpfivaldfpskqeverflrpfagtplfvkvgmelyyqegpaivaflkeqghavfldlk
lhdipntvkqamkglarvgadlvnvhaaggrrmmeaaiegldagtpsgrmrprciavtql
tstdermlheelwisrplvetvahyaalakesgldgvvcsaneaafikercgasflavtp
girfaddaarvvtprkaralgsdyivigrsltraadplrtyarlqhewn

SCOPe Domain Coordinates for d2yyub_:

Click to download the PDB-style file with coordinates for d2yyub_.
(The format of our PDB-style files is described here.)

Timeline for d2yyub_: