Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.3: Decarboxylase [51375] (4 proteins) |
Protein automated matches [190130] (11 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:235909] [188260] (2 PDB entries) |
Domain d2yyub_: 2yyu B: [170936] automated match to d1dbta_ complexed with c5p |
PDB Entry: 2yyu (more details), 2.2 Å
SCOPe Domain Sequences for d2yyub_:
Sequence, based on SEQRES records: (download)
>d2yyub_ c.1.2.3 (B:) automated matches {Geobacillus kaustophilus [TaxId: 235909]} htpfivaldfpskqeverflrpfagtplfvkvgmelyyqegpaivaflkeqghavfldlk lhdipntvkqamkglarvgadlvnvhaaggrrmmeaaiegldagtpsgrmrprciavtql tstdermlheelwisrplvetvahyaalakesgldgvvcsaneaafikercgasflavtp girfaddaahdqvrvvtprkaralgsdyivigrsltraadplrtyarlqhewn
>d2yyub_ c.1.2.3 (B:) automated matches {Geobacillus kaustophilus [TaxId: 235909]} htpfivaldfpskqeverflrpfagtplfvkvgmelyyqegpaivaflkeqghavfldlk lhdipntvkqamkglarvgadlvnvhaaggrrmmeaaiegldagtpsgrmrprciavtql tstdermlheelwisrplvetvahyaalakesgldgvvcsaneaafikercgasflavtp girfaddaarvvtprkaralgsdyivigrsltraadplrtyarlqhewn
Timeline for d2yyub_: