Lineage for d2yy6a_ (2yy6 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1628591Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1628592Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1629211Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1629212Protein automated matches [190447] (45 species)
    not a true protein
  7. 1629213Species Aquifex aeolicus [TaxId:224324] [188261] (2 PDB entries)
  8. 1629222Domain d2yy6a_: 2yy6 A: [170927]
    automated match to d2hsza1
    complexed with so4

Details for d2yy6a_

PDB Entry: 2yy6 (more details), 2.3 Å

PDB Description: Crystal Structure of the phosphoglycolate phosphatase from Aquifex aeolicus VF5
PDB Compounds: (A:) Phosphoglycolate phosphatase

SCOPe Domain Sequences for d2yy6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yy6a_ c.108.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}
mrvilfdldgtlidsakdialalektlkelgleeyypdnvtkyigggvrallekvlkdkf
reeyvevfrkhylenpvvytkpypeipytlealkskgfklavvsnkleelskkildilnl
sgyfdlivggdtfgekkpsptpvlktleilgeepekalivgdtdadieagkragtktala
lwgyvklnsqipdftlsrpsdlvklmdn

SCOPe Domain Coordinates for d2yy6a_:

Click to download the PDB-style file with coordinates for d2yy6a_.
(The format of our PDB-style files is described here.)

Timeline for d2yy6a_: