SCOPe 2.04: Domain d2yy6b_: 2yy6 B:

Lineage for d2yy6b_ (2yy6 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (45 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:224324] [188261] (2 PDB entries)

8. Domain d2yy6b_: 2yy6 B: [170928]
   automated match to d2hsza1
   complexed with so4

Details for d2yy6b_

PDB Entry: 2yy6, 2.3 Å

PDB Description: Crystal Structure of the phosphoglycolate phosphatase from Aquifex aeolicus VF5

PDB Compounds: (B:) Phosphoglycolate phosphatase

SCOPe Domain Sequences for d2yy6b_:

Sequence; same for both SEQRES and ATOM records:

>d2yy6b_ c.108.1.0 (B:) automated matches {Aquifex aeolicus [TaxId: 224324]}
mrvilfdldgtlidsakdialalektlkelgleeyypdnvtkyigggvrallekvlkdkf
reeyvevfrkhylenpvvytkpypeipytlealkskgfklavvsnkleelskkildilnl
sgyfdlivggdtfgekkpsptpvlktleilgeepekalivgdtdadieagkragtktala
lwgyvklnsqipdftlsrpsdlvklmdn

Timeline for d2yy6b_:

• d2yy6b_ first appeared in SCOPe 2.01
  
• d2yy6b_ appears in SCOPe 2.03
  
• d2yy6b_ appears in SCOPe 2.05
  
• d2yy6b_ appears in the current release, SCOPe 2.08