SCOPe 2.03: Domain d2yjyb_: 2yjy B:

Lineage for d2yjyb_ (2yjy B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (24 families)

5. Family a.118.1.8: Pumilio repeat [63611] (2 proteins)
   this is a repeat family; one repeat unit is 1ib2 A:982-1018 found in domain

6. Protein automated matches [191057] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189670] (4 PDB entries)

8. Domain d2yjyb_: 2yjy B: [170829]
   automated match to d1m8yb_
   protein/RNA complex

Details for d2yjyb_

PDB Entry: 2yjy, 2.6 Å

PDB Description: a specific and modular binding code for cytosine recognition in puf domains

PDB Compounds: (B:) Pumilio homolog 1

SCOPe Domain Sequences for d2yjyb_:

Sequence; same for both SEQRES and ATOM records:

>d2yjyb_ a.118.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grsrlledfrnnrypnlqlreiaghimefsqdqhgsrfiqlkleratpaerqlvfneilq
aayqlmvdvfgnyviqkffefgsleqklalaerirghvlslalqmygcrviqkalefips
dqqnemvreldghvlkcvkdqngnhvvqkciecvqpqslqfiidafkgqvfalsthpygc
rviqrilehclpdqtlpileelhqhteqlvqdqygsyvirhvlehgrpedkskivaeirg
nvlvlsqhkfasnvvekcvthasrteravlidevctmndgphsalytmmkdqyanyvvqk
midvaepgqrkivmhkirphiatlrkytygkhilaklekyy

Timeline for d2yjyb_:

• d2yjyb_ first appeared in SCOPe 2.01
  
• d2yjyb_ appears in SCOPe 2.02
  
• d2yjyb_ appears in SCOPe 2.04
  
• d2yjyb_ appears in the current release, SCOPe 2.08