Lineage for d2yjyb_ (2yjy B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2725793Family a.118.1.8: Pumilio repeat [63611] (2 proteins)
    this is a repeat family; one repeat unit is 1ib2 A:982-1018 found in domain
  6. 2725819Protein automated matches [191057] (3 species)
    not a true protein
  7. 2725823Species Human (Homo sapiens) [TaxId:9606] [189670] (4 PDB entries)
  8. 2725828Domain d2yjyb_: 2yjy B: [170829]
    automated match to d1m8yb_
    protein/RNA complex

Details for d2yjyb_

PDB Entry: 2yjy (more details), 2.6 Å

PDB Description: a specific and modular binding code for cytosine recognition in puf domains
PDB Compounds: (B:) Pumilio homolog 1

SCOPe Domain Sequences for d2yjyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yjyb_ a.118.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grsrlledfrnnrypnlqlreiaghimefsqdqhgsrfiqlkleratpaerqlvfneilq
aayqlmvdvfgnyviqkffefgsleqklalaerirghvlslalqmygcrviqkalefips
dqqnemvreldghvlkcvkdqngnhvvqkciecvqpqslqfiidafkgqvfalsthpygc
rviqrilehclpdqtlpileelhqhteqlvqdqygsyvirhvlehgrpedkskivaeirg
nvlvlsqhkfasnvvekcvthasrteravlidevctmndgphsalytmmkdqyanyvvqk
midvaepgqrkivmhkirphiatlrkytygkhilaklekyy

SCOPe Domain Coordinates for d2yjyb_:

Click to download the PDB-style file with coordinates for d2yjyb_.
(The format of our PDB-style files is described here.)

Timeline for d2yjyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2yjya_