Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H4 [47125] (7 species) |
Species Kluyveromyces lactis [TaxId:284590] [189974] (1 PDB entry) |
Domain d2yfvb_: 2yfv B: [170781] automated match to d1id3b_ complexed with iod |
PDB Entry: 2yfv (more details), 2.32 Å
SCOPe Domain Sequences for d2yfvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yfvb_ a.22.1.1 (B:) Histone H4 {Kluyveromyces lactis [TaxId: 284590]} dniqgitkpairrlarrggvkrisgliyeevrnvlktflesvirdavtytehakrktvts ldvvyalkrqgrtl
Timeline for d2yfvb_: