Lineage for d2yfvb_ (2yfv B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082620Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1082621Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 1082622Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1082927Protein Histone H4 [47125] (7 species)
  7. 1083040Species Kluyveromyces lactis [TaxId:284590] [189974] (1 PDB entry)
  8. 1083041Domain d2yfvb_: 2yfv B: [170781]
    automated match to d1id3b_
    complexed with iod

Details for d2yfvb_

PDB Entry: 2yfv (more details), 2.32 Å

PDB Description: the heterotrimeric complex of kluyveromyces lactis scm3, cse4 and h4
PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d2yfvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yfvb_ a.22.1.1 (B:) Histone H4 {Kluyveromyces lactis [TaxId: 284590]}
dniqgitkpairrlarrggvkrisgliyeevrnvlktflesvirdavtytehakrktvts
ldvvyalkrqgrtl

SCOPe Domain Coordinates for d2yfvb_:

Click to download the PDB-style file with coordinates for d2yfvb_.
(The format of our PDB-style files is described here.)

Timeline for d2yfvb_: