SCOPe 2.03: Domain d2yfvb_: 2yfv B:

Lineage for d2yfvb_ (2yfv B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (7 species)

7. Species Kluyveromyces lactis [TaxId:284590] [189974] (1 PDB entry)

8. Domain d2yfvb_: 2yfv B: [170781]
   Other proteins in same PDB: d2yfva_
   automated match to d1id3b_
   complexed with iod

Details for d2yfvb_

PDB Entry: 2yfv, 2.32 Å

PDB Description: the heterotrimeric complex of kluyveromyces lactis scm3, cse4 and h4

PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d2yfvb_:

Sequence; same for both SEQRES and ATOM records:

>d2yfvb_ a.22.1.1 (B:) Histone H4 {Kluyveromyces lactis [TaxId: 284590]}
dniqgitkpairrlarrggvkrisgliyeevrnvlktflesvirdavtytehakrktvts
ldvvyalkrqgrtl

Timeline for d2yfvb_:

• d2yfvb_ first appeared in SCOPe 2.01
  
• d2yfvb_ appears in SCOPe 2.02
  
• d2yfvb_ appears in SCOPe 2.04
  
• d2yfvb_ appears in the current release, SCOPe 2.08