SCOPe 2.07: Domain d2y43b_: 2y43 B:

Lineage for d2y43b_ (2y43 B:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.0: automated matches [191345] (1 protein)
   not a true family

6. Protein automated matches [190242] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189860] (11 PDB entries)

8. Domain d2y43b_: 2y43 B: [170590]
   automated match to d1jm7b_
   complexed with zn

Details for d2y43b_

PDB Entry: 2y43, 1.8 Å

PDB Description: rad18 ubiquitin ligase ring domain structure

PDB Compounds: (B:) e3 ubiquitin-protein ligase rad18

SCOPe Domain Sequences for d2y43b_:

Sequence; same for both SEQRES and ATOM records:

>d2y43b_ g.44.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srwppglavmktiddllrcgicfeyfniamiipqcshnycslcirkflsyktqcptccvt
vtepdlknnrildelvkslnfarnhllqf

Timeline for d2y43b_:

• d2y43b_ first appeared in SCOPe 2.01
  
• d2y43b_ appears in SCOPe 2.06
  
• d2y43b_ appears in the current release, SCOPe 2.08