Lineage for d1jm7b_ (1jm7 B:)
- Root: SCOPe 2.07
Class g: Small proteins [56992] (98 folds) 
Fold g.44: RING/U-box [57849] (1 superfamily)
dimetal(zinc)-bound alpha+beta motif; structurally diverseSuperfamily g.44.1: RING/U-box [57850] (7 families) 
Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins) 
Protein bard1 RING domain [69970] (1 species) Species Human (Homo sapiens) [TaxId:9606] [69971] (1 PDB entry) 
Domain d1jm7b_: 1jm7 B: [66881]
Other proteins in same PDB: d1jm7a_
heterodimer with brca1 RING domain
complexed with zn
Details for d1jm7b_
PDB Entry: 1jm7 (more details)
PDB Description: solution structure of the brca1/bard1 ring-domain heterodimer
PDB Compounds: (B:) brca1-associated ring domain protein 1SCOPe Domain Sequences for d1jm7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]}
mepdgrgawahsraaldrlekllrcsrctnilrepvclggcehifcsncvsdcigtgcpv
cytpawiqdlkinrqldsmiqlcsklrnllhdnelsd
SCOPe Domain Coordinates for d1jm7b_:
Click to download the PDB-style file with coordinates for d1jm7b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jm7b_:
- d1jm7b_ first appeared in SCOP 1.59
- d1jm7b_ appears in SCOPe 2.06
- d1jm7b_ appears in the current release, SCOPe 2.08
View in 3D
