Lineage for d2y3id_ (2y3i D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910394Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 2910395Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 2910396Family c.86.1.1: Phosphoglycerate kinase [53749] (2 proteins)
    Domain 2 binds ATP
    automatically mapped to Pfam PF00162
  6. 2910433Protein automated matches [190709] (5 species)
    not a true protein
  7. 2910437Species Human (Homo sapiens) [TaxId:9606] [188478] (25 PDB entries)
  8. 2910467Domain d2y3id_: 2y3i D: [170560]
    automated match to d1kf0a_
    complexed with 3pg, alf, cl, la8, mg

Details for d2y3id_

PDB Entry: 2y3i (more details), 2.9 Å

PDB Description: the structure of the fully closed conformation of human pgk in complex with l-adp, 3pg and the tsa aluminium tetrafluoride
PDB Compounds: (D:) Phosphoglycerate kinase 1

SCOPe Domain Sequences for d2y3id_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y3id_ c.86.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvlms
hlgrpdgvpmpdkyslepvavelksllgkdvlflkdcvgpevekacanpaagsvillenl
rfhveeegkgkdasgnkvkaepakieafraslsklgdvyvndafgtahrahssmvgvnlp
qkaggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggmaf
tflkvlnnmeigtslfdeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgqat
vasgipagwmgldcgpesskkyaeavtrakqivwngpvgvfeweafargtkalmdevvka
tsrgcitiigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsn

SCOPe Domain Coordinates for d2y3id_:

Click to download the PDB-style file with coordinates for d2y3id_.
(The format of our PDB-style files is described here.)

Timeline for d2y3id_: