SCOPe 2.07: Domain d1d1ma_: 1d1m A:

Lineage for d1d1ma_ (1d1m A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein cro lambda repressor [47428] (1 species)
   the fourth helix is replaced with a beta hairpin
   3 helices; folded leaf, opened

7. Species Bacteriophage lambda [TaxId:10710] [47429] (12 PDB entries)

8. Domain d1d1ma_: 1d1m A: [17056]
   insertion mutant k56-[dgevk]-f58w
   mutant

Details for d1d1ma_

PDB Entry: 1d1m, 2.05 Å

PDB Description: crystal structure of cro k56-[dgevk]-f58w mutant

PDB Compounds: (A:) lambda cro repressor

SCOPe Domain Sequences for d1d1ma_:

Sequence; same for both SEQRES and ATOM records:

>d1d1ma_ a.35.1.2 (A:) cro lambda repressor {Bacteriophage lambda [TaxId: 10710]}
meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkdgev
kpwps

Timeline for d1d1ma_:

• d1d1ma_ first appeared (with stable ids) in SCOP 1.55
  
• d1d1ma_ appears in SCOPe 2.06
  
• d1d1ma_ appears in the current release, SCOPe 2.08