SCOPe 2.07: Domain d2y20b1: 2y20 B:278-331

Lineage for d2y20b1 (2y20 B:278-331)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.274: HAMP domain-like [158471] (1 superfamily)
   dimer of helix-loop-helix segments; distict from the HLH-like fold; parallel four-helical bundle with two overside connections

4. Superfamily a.274.1: HAMP domain-like [158472] (1 family)
   automatically mapped to Pfam PF00672

5. Family a.274.1.1: HAMP domain [158473] (2 proteins)
   Pfam PF00672

6. Protein automated matches [191239] (1 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [189690] (6 PDB entries)

8. Domain d2y20b1: 2y20 B:278-331 [170518]
   Other proteins in same PDB: d2y20b2, d2y20c2, d2y20d2, d2y20e2, d2y20f2
   automated match to d2aswa1
   complexed with zn; mutant

Details for d2y20b1

PDB Entry: 2y20, 1.65 Å

PDB Description: the mechanisms of hamp-mediated signaling in transmembrane receptors - the a291i mutant

PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d2y20b1:

Sequence; same for both SEQRES and ATOM records:

>d2y20b1 a.274.1.1 (B:278-331) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
stitrpiielsntidkiaegnleaevphqnradeigilaksierlrrslkvame

Timeline for d2y20b1:

• d2y20b1 first appeared in SCOPe 2.01, called d2y20b_
  
• d2y20b1 appears in SCOPe 2.06
  
• d2y20b1 appears in the current release, SCOPe 2.08