| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.274: HAMP domain-like [158471] (1 superfamily) dimer of helix-loop-helix segments; distict from the HLH-like fold; parallel four-helical bundle with two overside connections |
Superfamily a.274.1: HAMP domain-like [158472] (1 family) ![]() |
| Family a.274.1.1: HAMP domain [158473] (2 proteins) Pfam PF00672 |
| Protein automated matches [191239] (1 species) not a true protein |
| Species Archaeoglobus fulgidus [TaxId:2234] [189690] (4 PDB entries) |
| Domain d2y20b_: 2y20 B: [170518] automated match to d2aswa1 complexed with zn; mutant |
PDB Entry: 2y20 (more details), 1.65 Å
SCOPe Domain Sequences for d2y20b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y20b_ a.274.1.1 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
hmstitrpiielsntidkiaegnleaevphqnradeigilaksierlrrslkvame
Timeline for d2y20b_: