Lineage for d2y20b_ (2y20 B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 928931Fold a.274: HAMP domain-like [158471] (1 superfamily)
    dimer of helix-loop-helix segments; distict from the HLH-like fold; parallel four-helical bundle with two overside connections
  4. 928932Superfamily a.274.1: HAMP domain-like [158472] (1 family) (S)
  5. 928933Family a.274.1.1: HAMP domain [158473] (2 proteins)
    Pfam PF00672
  6. 928938Protein automated matches [191239] (1 species)
    not a true protein
  7. 928939Species Archaeoglobus fulgidus [TaxId:2234] [189690] (4 PDB entries)
  8. 928943Domain d2y20b_: 2y20 B: [170518]
    automated match to d2aswa1
    complexed with zn; mutant

Details for d2y20b_

PDB Entry: 2y20 (more details), 1.65 Å

PDB Description: the mechanisms of hamp-mediated signaling in transmembrane receptors - the a291i mutant
PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d2y20b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y20b_ a.274.1.1 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
hmstitrpiielsntidkiaegnleaevphqnradeigilaksierlrrslkvame

SCOPe Domain Coordinates for d2y20b_:

Click to download the PDB-style file with coordinates for d2y20b_.
(The format of our PDB-style files is described here.)

Timeline for d2y20b_: