Lineage for d2xzwc_ (2xzw C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1651257Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1651258Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. 1651332Protein automated matches [190670] (6 species)
    not a true protein
  7. 1651356Species Synechococcus elongatus PCC 7942 [TaxId:1140] [189437] (3 PDB entries)
  8. 1651360Domain d2xzwc_: 2xzw C: [170499]
    automated match to d1qy7a_
    complexed with akg, atp, mg

Details for d2xzwc_

PDB Entry: 2xzw (more details), 1.95 Å

PDB Description: structure of pii from synechococcus elongatus in complex with 2-oxoglutarate at low 2-og concentrations
PDB Compounds: (C:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d2xzwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xzwc_ d.58.5.1 (C:) automated matches {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadais

SCOPe Domain Coordinates for d2xzwc_:

Click to download the PDB-style file with coordinates for d2xzwc_.
(The format of our PDB-style files is described here.)

Timeline for d2xzwc_: