Lineage for d1qy7a_ (1qy7 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1651257Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1651258Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. 1651264Protein PII (product of glnB) [54915] (7 species)
    trimer with orthogonal packing of beta-sheets around the threefold axis
  7. 1651272Species Cyanobacteria (Synechococcus sp.) pcc 7942 [TaxId:1131] [102970] (4 PDB entries)
  8. 1651274Domain d1qy7a_: 1qy7 A: [96575]
    complexed with ni, so4

Details for d1qy7a_

PDB Entry: 1qy7 (more details), 2 Å

PDB Description: the structure of the pii protein from the cyanobacteria synechococcus sp. pcc 7942
PDB Compounds: (A:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d1qy7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qy7a_ d.58.5.1 (A:) PII (product of glnB) {Cyanobacteria (Synechococcus sp.) pcc 7942 [TaxId: 1131]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgaeytveflqklk
leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai

SCOPe Domain Coordinates for d1qy7a_:

Click to download the PDB-style file with coordinates for d1qy7a_.
(The format of our PDB-style files is described here.)

Timeline for d1qy7a_: