![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.86: Coronavirus NSP10-like [144245] (1 superfamily) binds two zinc ion per subunit; forms a dodecameric shell |
![]() | Superfamily g.86.1: Coronavirus NSP10-like [144246] (1 family) ![]() automatically mapped to Pfam PF09401 |
![]() | Family g.86.1.1: Coronavirus NSP10-like [144247] (2 proteins) partly covered by PfamB PB001266 |
![]() | Protein automated matches [191249] (3 species) not a true protein |
![]() | Species SARS coronavirus [TaxId:227859] [189770] (4 PDB entries) |
![]() | Domain d2xyvb_: 2xyv B: [170489] Other proteins in same PDB: d2xyva_ automated match to d2g9ta1 complexed with cl, mg, na, sah, zn |
PDB Entry: 2xyv (more details), 2.06 Å
SCOPe Domain Sequences for d2xyvb_:
Sequence, based on SEQRES records: (download)
>d2xyvb_ g.86.1.1 (B:) automated matches {SARS coronavirus [TaxId: 227859]} stvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesfgg ascclycrchidhpnpkgfcdlkgkfvqipttcandpvgftlrntvctvcgmwkgygcs
>d2xyvb_ g.86.1.1 (B:) automated matches {SARS coronavirus [TaxId: 227859]} stvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesfgg ascclycrchidhpncdlkgkfvqipttcandpvgftlrntvctvcgmwkgygcs
Timeline for d2xyvb_: