Lineage for d2xyva_ (2xyv A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893582Family c.66.1.25: mRNA cap methylase [88785] (4 proteins)
  6. 2893627Protein SARS coronavirus nsp16 [419230] (1 species)
    Pfam PF06460
  7. 2893628Species SARS-CoV coronavirus [TaxId:227859] [419755] (3 PDB entries)
  8. 2893630Domain d2xyva_: 2xyv A: [408259]
    Other proteins in same PDB: d2xyvb_
    automated match to d2xyqa_
    complexed with cl, mg, na, sah, zn

Details for d2xyva_

PDB Entry: 2xyv (more details), 2.06 Å

PDB Description: crystal structure of the nsp16 nsp10 sars coronavirus complex
PDB Compounds: (A:) putative 2'-o-methyl transferase

SCOPe Domain Sequences for d2xyva_:

Sequence, based on SEQRES records: (download)

>d2xyva_ c.66.1.25 (A:) SARS coronavirus nsp16 {SARS-CoV coronavirus [TaxId: 227859]}
sqawqpgvampnlykmqrmllekcdlqnygenavipkgimmnvakytqlcqylntltlav
pynmrvihfgagsdkgvapgtavlrqwlptgtllvdsdlndfvsdadstligdcatvhta
nkwdliisdmydprtkhvtkendskegfftylcgfikqklalggsiavkitehswnadly
klmghfswwtafvtnvnassseafliganylgkpkeqidgytmhanyifwrntnpiqlss
yslfdmskfplklrgtavmslkenqindmiysllekgrliirennrvvvss

Sequence, based on observed residues (ATOM records): (download)

>d2xyva_ c.66.1.25 (A:) SARS coronavirus nsp16 {SARS-CoV coronavirus [TaxId: 227859]}
sqawqpgvampnlykmqrmllekcdlqnygenavipkgimmnvakytqlcqylntltlav
pynmrvihfgagsdkgvapgtavlrqwlptgtllvdsdlndfvsdadstligdcatvhta
nkwdliisdmydpkendskegfftylcgfikqklalggsiavkitehswnadlyklmghf
swwtafvtnvnassseafliganylgkpkeqidgytmhanyifwrntnpiqlssyslfdm
skfplklrgtavmslkenqindmiysllekgrliirennrvvvss

SCOPe Domain Coordinates for d2xyva_:

Click to download the PDB-style file with coordinates for d2xyva_.
(The format of our PDB-style files is described here.)

Timeline for d2xyva_:

  • d2xyva_ is new in SCOPe 2.08-stable