| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (11 species) not a true protein |
| Species Vicugna pacos [TaxId:30538] [189756] (4 PDB entries) |
| Domain d2xv6b_: 2xv6 B: [170417] automated match to d2p42b1 |
PDB Entry: 2xv6 (more details), 1.89 Å
SCOPe Domain Sequences for d2xv6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xv6b_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
aqvqlvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmstv
yddsvkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvss
Timeline for d2xv6b_: