| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins) |
| Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species) |
| Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (22 PDB entries) SQ NA # camelid antibody |
| Domain d2p42b1: 2p42 B:1-121 [149195] Other proteins in same PDB: d2p42a1, d2p42c1 automatically matched to d1bzqk_ complexed with mg |
PDB Entry: 2p42 (more details), 1.8 Å
SCOP Domain Sequences for d2p42b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p42b1 b.1.1.1 (B:1-121) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggtly
adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvtvs
s
Timeline for d2p42b1: