Lineage for d2p42b_ (2p42 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742101Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)
  8. 2742113Domain d2p42b_: 2p42 B: [149195]
    Other proteins in same PDB: d2p42a_, d2p42c_
    automated match to d1bzqk_
    protein/RNA complex; complexed with mg

Details for d2p42b_

PDB Entry: 2p42 (more details), 1.8 Å

PDB Description: Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.8A resolution: SE3-mono-2 crystal form with three se-met sites (M34, M51, M83) in vhh scaffold
PDB Compounds: (B:) antibody cab-rn05

SCOPe Domain Sequences for d2p42b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p42b_ b.1.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggtly
adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvtvs
s

SCOPe Domain Coordinates for d2p42b_:

Click to download the PDB-style file with coordinates for d2p42b_.
(The format of our PDB-style files is described here.)

Timeline for d2p42b_: