Lineage for d2xuma_ (2xum A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2424882Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2425103Family b.82.2.6: Hypoxia-inducible factor HIF ihhibitor (FIH1) [82194] (1 protein)
  6. 2425104Protein Hypoxia-inducible factor HIF ihhibitor (FIH1) [82195] (1 species)
  7. 2425105Species Human (Homo sapiens) [TaxId:9606] [82196] (34 PDB entries)
  8. 2425127Domain d2xuma_: 2xum A: [170406]
    automated match to d1iz3a_
    complexed with oga, so4, zn; mutant

Details for d2xuma_

PDB Entry: 2xum (more details), 2.2 Å

PDB Description: factor inhibiting hif (fih) q239h mutant in complex with zn(ii), nog and asp-substrate peptide (20-mer)
PDB Compounds: (A:) Hypoxia-inducible factor 1-alpha inhibitor

SCOPe Domain Sequences for d2xuma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xuma_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]}
maataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelienee
pvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnr
eemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwg
qltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrhs
qvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykga
ptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn

SCOPe Domain Coordinates for d2xuma_:

Click to download the PDB-style file with coordinates for d2xuma_.
(The format of our PDB-style files is described here.)

Timeline for d2xuma_: