| Class b: All beta proteins [48724] (180 folds) |
| Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
| Family b.82.2.6: Hypoxia-inducible factor HIF ihhibitor (FIH1) [82194] (1 protein) |
| Protein Hypoxia-inducible factor HIF ihhibitor (FIH1) [82195] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [82196] (38 PDB entries) |
| Domain d2xuma_: 2xum A: [170406] automated match to d1iz3a_ complexed with oga, so4, zn; mutant |
PDB Entry: 2xum (more details), 2.2 Å
SCOPe Domain Sequences for d2xuma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xuma_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]}
maataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelienee
pvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnr
eemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwg
qltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrhs
qvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykga
ptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn
Timeline for d2xuma_: