SCOPe 2.03: Domain d2xt1b_: 2xt1 B:

Lineage for d2xt1b_ (2xt1 B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (16 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (5 PDB entries)

8. Domain d2xt1b_: 2xt1 B: [170378]
   Other proteins in same PDB: d2xt1a_
   automated match to d2p42b1
   complexed with gol

Details for d2xt1b_

PDB Entry: 2xt1, 1.32 Å

PDB Description: crystal structure of the hiv-1 capsid protein c-terminal domain (146- 231) in complex with a camelid vhh.

PDB Compounds: (B:) camelid vhh 9

SCOPe Domain Sequences for d2xt1b_:

Sequence; same for both SEQRES and ATOM records:

>d2xt1b_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
aqvqlvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmstv
yddsvkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvss

Timeline for d2xt1b_:

• d2xt1b_ first appeared in SCOPe 2.01
  
• d2xt1b_ appears in SCOPe 2.02
  
• d2xt1b_ appears in SCOPe 2.04
  
• d2xt1b_ appears in the current release, SCOPe 2.08, called d2xt1b1