Lineage for d2xt1b_ (2xt1 B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1105645Protein automated matches [190119] (15 species)
    not a true protein
  7. 1105895Species Vicugna pacos [TaxId:30538] [189756] (5 PDB entries)
  8. 1105896Domain d2xt1b_: 2xt1 B: [170378]
    automated match to d2p42b1
    complexed with gol

Details for d2xt1b_

PDB Entry: 2xt1 (more details), 1.32 Å

PDB Description: crystal structure of the hiv-1 capsid protein c-terminal domain (146- 231) in complex with a camelid vhh.
PDB Compounds: (B:) camelid vhh 9

SCOPe Domain Sequences for d2xt1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xt1b_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
aqvqlvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmstv
yddsvkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvss

SCOPe Domain Coordinates for d2xt1b_:

Click to download the PDB-style file with coordinates for d2xt1b_.
(The format of our PDB-style files is described here.)

Timeline for d2xt1b_: