PDB entry 2xt1

View 2xt1 on RCSB PDB site
Description: crystal structure of the hiv-1 capsid protein c-terminal domain (146-231) in complex with a camelid vhh.
Class: viral protein/immune system
Keywords: viral protein-immune system complex
Deposited on 2010-10-03, released 2011-10-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.1618
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gag polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71B32 (0-85)
      • conflict (62)
    Domains in SCOPe 2.03: d2xt1a_
  • Chain 'B':
    Compound: camelid vhh 9
    Species: VICUGNA PACOS [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XT1 (Start-114)
    Domains in SCOPe 2.03: d2xt1b_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xt1A (A:)
    sptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkal
    gpgatleemmtacqgvggpghkarvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xt1B (B:)
    maqvqlvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmst
    vyddsvkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvsshhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xt1B (B:)
    aqvqlvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmstv
    yddsvkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvss