Lineage for d2xlbg_ (2xlb G:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509052Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 proteins)
    Pfam PF05448; AXE1
  6. 2509105Protein automated matches [191114] (2 species)
    not a true protein
  7. 2509106Species Bacillus pumilus [TaxId:1408] [189177] (6 PDB entries)
  8. 2509113Domain d2xlbg_: 2xlb G: [170202]
    automated match to d1odtc_

Details for d2xlbg_

PDB Entry: 2xlb (more details), 1.9 Å

PDB Description: acetyl xylan esterase from bacillus pumilus without ligands
PDB Compounds: (G:) acetyl xylan esterase

SCOPe Domain Sequences for d2xlbg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xlbg_ c.69.1.25 (G:) automated matches {Bacillus pumilus [TaxId: 1408]}
mqlfdlsleelkkykpkktarpdfadfwkksleelrqveaeptlesydypvkgvkvyrlt
yqsfghskiegfyavpdqtgphpalvrfhgynasyddgihdivnwalhgyatfgmlvrgq
ggsedtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigvigg
sqggalaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpeveek
afetlsyfdlinlagwvkqptlmaiglidqvtppstvfaaynhletdkelkvyryfghef
ipafqteklsflqkhll

SCOPe Domain Coordinates for d2xlbg_:

Click to download the PDB-style file with coordinates for d2xlbg_.
(The format of our PDB-style files is described here.)

Timeline for d2xlbg_: