Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) has additional strand at N-terminus |
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
Protein automated matches [190916] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189462] (3 PDB entries) |
Domain d2xjka_: 2xjk A: [170132] automated match to d1ba9a_ complexed with cu, zn |
PDB Entry: 2xjk (more details), 1.45 Å
SCOPe Domain Sequences for d2xjka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xjka_ b.1.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvheeedntagctsa gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhaiigrtlvvh ekaddlgkggneestktgnagsrlacgvigiaq
Timeline for d2xjka_: