Lineage for d2xjka_ (2xjk A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2763709Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2764372Protein automated matches [190916] (13 species)
    not a true protein
  7. 2764390Species Human (Homo sapiens) [TaxId:9606] [189462] (4 PDB entries)
  8. 2764393Domain d2xjka_: 2xjk A: [170132]
    automated match to d1ba9a_
    complexed with cu, zn

Details for d2xjka_

PDB Entry: 2xjk (more details), 1.45 Å

PDB Description: monomeric human cu,zn superoxide dismutase
PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d2xjka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xjka_ b.1.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvheeedntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhaiigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

SCOPe Domain Coordinates for d2xjka_:

Click to download the PDB-style file with coordinates for d2xjka_.
(The format of our PDB-style files is described here.)

Timeline for d2xjka_: