SCOPe 2.07: Domain d2xblb_: 2xbl B:

Lineage for d2xblb_ (2xbl B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (4 families)

5. Family c.80.1.0: automated matches [191405] (1 protein)
   not a true family

6. Protein automated matches [190547] (16 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:272560] [189351] (5 PDB entries)

8. Domain d2xblb_: 2xbl B: [169994]
   automated match to d1tk9a_
   complexed with m7p, peg, pg4, pge, zn

Details for d2xblb_

PDB Entry: 2xbl, 1.62 Å

PDB Description: crystal structure of gmha from burkholderia pseudomallei in complex with product

PDB Compounds: (B:) Phosphoheptose isomerase

SCOPe Domain Sequences for d2xblb_:

Sequence; same for both SEQRES and ATOM records:

>d2xblb_ c.80.1.0 (B:) automated matches {Burkholderia pseudomallei [TaxId: 272560]}
nreltyitnsiaeaqrvmaamladerllatvrkvadaciasiaqggkvllagnggsaada
qhiagefvsrfafdrpglpavalttdtsiltaigndygyeklfsrqvqalgnegdvligy
stsgkspnilaafreakakgmtcvgftgnrggemrelcdlllevpsadtpkiqeghlvlg
hivcglvehsifg

Timeline for d2xblb_:

• d2xblb_ first appeared in SCOPe 2.01
  
• d2xblb_ appears in SCOPe 2.06
  
• d2xblb_ appears in the current release, SCOPe 2.08