Lineage for d1b3qa1 (1b3q A:293-354)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97071Fold a.30: ROP-like [47379] (2 superfamilies)
  4. 97093Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (1 family) (S)
  5. 97094Family a.30.2.1: Homodimeric domain of signal transducing histidine kinase [47385] (2 proteins)
  6. 97099Protein Histidine kinase CheA [47388] (1 species)
  7. 97100Species Thermotoga maritima [TaxId:243274] [47389] (1 PDB entry)
  8. 97101Domain d1b3qa1: 1b3q A:293-354 [16993]
    Other proteins in same PDB: d1b3qa2, d1b3qa3, d1b3qb2, d1b3qb3

Details for d1b3qa1

PDB Entry: 1b3q (more details), 2.6 Å

PDB Description: crystal structure of chea-289, a signal transducing histidine kinase

SCOP Domain Sequences for d1b3qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b3qa1 a.30.2.1 (A:293-354) Histidine kinase CheA {Thermotoga maritima}
sqtvrvdiekldnlmdlmgelviarsriletlkkynikeldeslshlsritldlqnvvmk
ir

SCOP Domain Coordinates for d1b3qa1:

Click to download the PDB-style file with coordinates for d1b3qa1.
(The format of our PDB-style files is described here.)

Timeline for d1b3qa1: