![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
![]() | Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
![]() | Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
![]() | Protein automated matches [190055] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187785] (61 PDB entries) |
![]() | Domain d2x7za_: 2x7z A: [169928] automated match to d1qlca_ complexed with imd, nh4; mutant |
PDB Entry: 2x7z (more details), 2 Å
SCOPe Domain Sequences for d2x7za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x7za_ b.36.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gskpvsekimeiklikgpkglgfsiaggvgnqhwpgdnsiyvtkiieggaahkdgklqig dkllavnnvaleevtheeavtalkntsdfvylkvakpts
Timeline for d2x7za_: