Lineage for d2x71a_ (2x71 A:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1054403Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1054404Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1054405Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1054945Protein automated matches [190161] (13 species)
    not a true protein
  7. 1054946Species Bacillus licheniformis [TaxId:1402] [188244] (4 PDB entries)
  8. 1054949Domain d2x71a_: 2x71 A: [169913]
    automated match to d1i2wb_
    complexed with eoh, l4c, so4

Details for d2x71a_

PDB Entry: 2x71 (more details), 2.1 Å

PDB Description: structural basis for the interaction of lactivicins with serine beta-lactamases
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d2x71a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x71a_ e.3.1.1 (A:) automated matches {Bacillus licheniformis [TaxId: 1402]}
ddfakleeqfdaklgifaldtgtnrtvtyrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdntaqnlilkqiggpeslkkelr
kigdevtnperfepelnevnpgetqdtstaralatslqafaledklpsekrellidwmkr
nttgdaliragvpegwevadktgagsygtrndiaiiwppkgdpvvlavlssrdkkdakyd
dkliaeatkvvvkal

SCOPe Domain Coordinates for d2x71a_:

Click to download the PDB-style file with coordinates for d2x71a_.
(The format of our PDB-style files is described here.)

Timeline for d2x71a_: