Lineage for d2x4ka1 (2x4k A:1-61)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2567390Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2567391Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2568075Family d.80.1.0: automated matches [191533] (1 protein)
    not a true family
  6. 2568076Protein automated matches [190903] (22 species)
    not a true protein
  7. 2568227Species Staphylococcus aureus [TaxId:1280] [189405] (1 PDB entry)
  8. 2568228Domain d2x4ka1: 2x4k A:1-61 [169857]
    Other proteins in same PDB: d2x4ka2, d2x4kb2
    automated match to d1bjpa_
    complexed with act, po4, zn

Details for d2x4ka1

PDB Entry: 2x4k (more details), 1.1 Å

PDB Description: crystal structure of sar1376, a putative 4-oxalocrotonate tautomerase from the methicillin-resistant staphylococcus aureus (mrsa)
PDB Compounds: (A:) 4-oxalocrotonate tautomerase

SCOPe Domain Sequences for d2x4ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x4ka1 d.80.1.0 (A:1-61) automated matches {Staphylococcus aureus [TaxId: 1280]}
mmpivnvkllegrsdeqlknlvsevtdavekttganrqaihvvieemkpnhygvagvrks
d

SCOPe Domain Coordinates for d2x4ka1:

Click to download the PDB-style file with coordinates for d2x4ka1.
(The format of our PDB-style files is described here.)

Timeline for d2x4ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2x4ka2