![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
![]() | Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) ![]() |
![]() | Family d.80.1.0: automated matches [191533] (1 protein) not a true family |
![]() | Protein automated matches [190903] (18 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [189405] (1 PDB entry) |
![]() | Domain d2x4ka1: 2x4k A:1-61 [169857] Other proteins in same PDB: d2x4ka2, d2x4kb2 automated match to d1bjpa_ complexed with act, po4, zn |
PDB Entry: 2x4k (more details), 1.1 Å
SCOPe Domain Sequences for d2x4ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x4ka1 d.80.1.0 (A:1-61) automated matches {Staphylococcus aureus [TaxId: 1280]} mmpivnvkllegrsdeqlknlvsevtdavekttganrqaihvvieemkpnhygvagvrks d
Timeline for d2x4ka1: