Lineage for d2x2de_ (2x2d E:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1091822Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 1091823Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family) (S)
  5. 1091824Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 1091922Protein automated matches [190369] (4 species)
    not a true protein
  7. 1091923Species Human immunodeficiency virus 1 [TaxId:11676] [187207] (4 PDB entries)
  8. 1091929Domain d2x2de_: 2x2d E: [169824]
    Other proteins in same PDB: d2x2db_, d2x2dc_
    automated match to d1afva_

Details for d2x2de_

PDB Entry: 2x2d (more details), 1.9 Å

PDB Description: acetyl-cypa:hiv-1 n-term capsid domain complex
PDB Compounds: (E:) capsid protein p24

SCOPe Domain Sequences for d2x2de_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x2de_ a.73.1.1 (E:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
vhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlk
etineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmthnppipvgeiy
krwiilglnkivrmys

SCOPe Domain Coordinates for d2x2de_:

Click to download the PDB-style file with coordinates for d2x2de_.
(The format of our PDB-style files is described here.)

Timeline for d2x2de_: