![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
![]() | Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family) ![]() |
![]() | Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
![]() | Protein automated matches [190369] (4 species) not a true protein |
![]() | Species Human immunodeficiency virus 1 [TaxId:11676] [187207] (4 PDB entries) |
![]() | Domain d2x2de_: 2x2d E: [169824] Other proteins in same PDB: d2x2db_, d2x2dc_ automated match to d1afva_ |
PDB Entry: 2x2d (more details), 1.9 Å
SCOPe Domain Sequences for d2x2de_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x2de_ a.73.1.1 (E:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} vhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlk etineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmthnppipvgeiy krwiilglnkivrmys
Timeline for d2x2de_: