SCOPe 2.05: Domain d1gtoa_: 1gto A:

Lineage for d1gtoa_ (1gto A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.1: ROP protein [47380] (1 family)
   automatically mapped to Pfam PF01815

5. Family a.30.1.1: ROP protein [47381] (1 protein)

6. Protein ROP protein [47382] (1 species)

7. Species Escherichia coli [TaxId:562] [47383] (17 PDB entries)
   Uniprot P03051

8. Domain d1gtoa_: 1gto A: [16980]
   mutant

Details for d1gtoa_

PDB Entry: 1gto, 1.82 Å

PDB Description: high resolution structure of a hyperstable helical bundle protein mutant

PDB Compounds: (A:) rop

SCOPe Domain Sequences for d1gtoa_:

Sequence; same for both SEQRES and ATOM records:

>d1gtoa_ a.30.1.1 (A:) ROP protein {Escherichia coli [TaxId: 562]}
gtkqektalnmarfirsqtltlleklnelgadeqadiceslhdhadelyrsclarfgddg
en

Timeline for d1gtoa_:

• d1gtoa_ first appeared (with stable ids) in SCOP 1.55
  
• d1gtoa_ appears in SCOPe 2.04
  
• d1gtoa_ appears in SCOPe 2.06
  
• d1gtoa_ appears in the current release, SCOPe 2.08