Lineage for d1gtoa_ (1gto A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2917Fold a.30: ROP-like [47379] (2 superfamilies)
  4. 2918Superfamily a.30.1: ROP protein [47380] (1 family) (S)
  5. 2919Family a.30.1.1: ROP protein [47381] (1 protein)
  6. 2920Protein ROP protein [47382] (1 species)
  7. 2921Species Escherichia coli [TaxId:562] [47383] (8 PDB entries)
  8. 2928Domain d1gtoa_: 1gto A: [16980]

Details for d1gtoa_

PDB Entry: 1gto (more details), 1.82 Å

PDB Description: high resolution structure of a hyperstable helical bundle protein mutant

SCOP Domain Sequences for d1gtoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtoa_ a.30.1.1 (A:) ROP protein {Escherichia coli}
gtkqektalnmarfirsqtltlleklnelgadeqadiceslhdhadelyrsclarfgddg
en

SCOP Domain Coordinates for d1gtoa_:

Click to download the PDB-style file with coordinates for d1gtoa_.
(The format of our PDB-style files is described here.)

Timeline for d1gtoa_: