SCOPe 2.01: Domain d2x1qb_: 2x1q B:

Lineage for d2x1qb_ (2x1q B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (11 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (12 PDB entries)

8. Domain d2x1qb_: 2x1q B: [169797]
   automated match to d1ol0a_

Details for d2x1qb_

PDB Entry: 2x1q, 1.06 Å

PDB Description: gelsolin nanobody

PDB Compounds: (B:) gelsolin nanobody

SCOPe Domain Sequences for d2x1qb_:

Sequence, based on SEQRES records:

>d2x1qb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlqesggglvqpggslrlscaasgrtfsnyrmgwfrqapgkerefvatisqsgaatayad
svkgrftfsrdnaknllylemlslepedtavyycaassrvfytevlqtttgydywgqgtq
vtvss

Sequence, based on observed residues (ATOM records):

>d2x1qb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlqesggglvqpggslrlscaafsnyrmgwfrqapgkerefvatisqsgaatayadsvkg
rftfsrdnaknllylemlslepedtavyycaassrvfytevlqtttgydywgqgtqvtvs
s

Timeline for d2x1qb_:

• d2x1qb_ is new in SCOPe 2.01-stable
  
• d2x1qb_ appears in SCOPe 2.02
  
• d2x1qb_ appears in the current release, SCOPe 2.08, called d2x1qb1