Lineage for d2x1qb1 (2x1q B:6-127)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (155 PDB entries)
  8. 2347653Domain d2x1qb1: 2x1q B:6-127 [169797]
    Other proteins in same PDB: d2x1qa2, d2x1qb2
    automated match to d1ol0a_

Details for d2x1qb1

PDB Entry: 2x1q (more details), 1.06 Å

PDB Description: gelsolin nanobody
PDB Compounds: (B:) gelsolin nanobody

SCOPe Domain Sequences for d2x1qb1:

Sequence, based on SEQRES records: (download)

>d2x1qb1 b.1.1.1 (B:6-127) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgrtfsnyrmgwfrqapgkerefvatisqsgaatayadsvk
grftfsrdnaknllylemlslepedtavyycaassrvfytevlqtttgydywgqgtqvtv
ss

Sequence, based on observed residues (ATOM records): (download)

>d2x1qb1 b.1.1.1 (B:6-127) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaafsnyrmgwfrqapgkerefvatisqsgaatayadsvkgrft
fsrdnaknllylemlslepedtavyycaassrvfytevlqtttgydywgqgtqvtvss

SCOPe Domain Coordinates for d2x1qb1:

Click to download the PDB-style file with coordinates for d2x1qb1.
(The format of our PDB-style files is described here.)

Timeline for d2x1qb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2x1qb2