Lineage for d2x06f_ (2x06 F:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1012023Fold c.122: L-sulfolactate dehydrogenase-like [89732] (1 superfamily)
    core: 3 layers, a/b/a; mixed sheet of 7 strands, order 1237456; strands 1, 6 and 7 are antiparallel to the rest
  4. 1012024Superfamily c.122.1: L-sulfolactate dehydrogenase-like [89733] (1 family) (S)
    topological similarity to the domain 2 of TM1585
  5. 1012025Family c.122.1.1: L-sulfolactate dehydrogenase-like [89734] (3 proteins)
    Pfam PF02615; type II malate/L-lactate dehydrogenase;
  6. 1012038Protein L-sulfolactate dehydrogenase [102550] (1 species)
  7. 1012039Species Methanococcus jannaschii [TaxId:2190] [102551] (1 PDB entry)
  8. 1012045Domain d2x06f_: 2x06 F: [169748]
    automated match to d1rfma_
    complexed with nad

Details for d2x06f_

PDB Entry: 2x06 (more details), 2.5 Å

PDB Description: sulfolactate dehydrogenase from methanocaldococcus jannaschii
PDB Compounds: (F:) l-sulfolactate dehydrogenase

SCOPe Domain Sequences for d2x06f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x06f_ c.122.1.1 (F:) L-sulfolactate dehydrogenase {Methanococcus jannaschii [TaxId: 2190]}
milkpenekkliidvlkkfgvpeedakitadvfvdadlkgftshgigrfpqyitalklgn
inpkpdikivkespatavidgdlglgqvvgkkamelaikkaknvgvgvvatrnanhfgia
gyyselamnqdmigititntepamapfggkekilgtnpiaiafkgnkykfsldmatasia
rgkilealrkkikipegcavdkdgkpttdpakalegcilpfggpkgyglalaiemlsaig
gaevgtkvkgtanpeerctkgdlfiainpeffmgkeefkrkvdelldeiknsepaegfei
lipgeieernkmkrkdgfeidknlynqlkeicnelglniedyie

SCOPe Domain Coordinates for d2x06f_:

Click to download the PDB-style file with coordinates for d2x06f_.
(The format of our PDB-style files is described here.)

Timeline for d2x06f_: