PDB entry 2x06

View 2x06 on RCSB PDB site
Description: sulfolactate dehydrogenase from methanocaldococcus jannaschii
Class: oxidoreductase
Keywords: oxidoreductase, hyperthermostable, coenzyme m, methanogens, coenzyme m biosynthesis, pro-s hydrogen transfer, nad-binding without a rossmann fold
Deposited on 2009-12-07, released 2009-12-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.1567
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-sulfolactate dehydrogenase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2x06a_
  • Chain 'B':
    Compound: l-sulfolactate dehydrogenase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2x06b_
  • Chain 'C':
    Compound: l-sulfolactate dehydrogenase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2x06c_
  • Chain 'D':
    Compound: l-sulfolactate dehydrogenase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2x06d_
  • Chain 'E':
    Compound: l-sulfolactate dehydrogenase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2x06e_
  • Chain 'F':
    Compound: l-sulfolactate dehydrogenase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2x06f_
  • Chain 'G':
    Compound: l-sulfolactate dehydrogenase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2x06g_
  • Chain 'H':
    Compound: l-sulfolactate dehydrogenase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2x06h_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2x06A (A:)
    milkpenekkliidvlkkfgvpeedakitadvfvdadlkgftshgigrfpqyitalklgn
    inpkpdikivkespatavidgdlglgqvvgkkamelaikkaknvgvgvvatrnanhfgia
    gyyselamnqdmigititntepamapfggkekilgtnpiaiafkgnkykfsldmatasia
    rgkilealrkkikipegcavdkdgkpttdpakalegcilpfggpkgyglalaiemlsaig
    gaevgtkvkgtanpeerctkgdlfiainpeffmgkeefkrkvdelldeiknsepaegfei
    lipgeieernkmkrkdgfeidknlynqlkeicnelglniedyie
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2x06B (B:)
    milkpenekkliidvlkkfgvpeedakitadvfvdadlkgftshgigrfpqyitalklgn
    inpkpdikivkespatavidgdlglgqvvgkkamelaikkaknvgvgvvatrnanhfgia
    gyyselamnqdmigititntepamapfggkekilgtnpiaiafkgnkykfsldmatasia
    rgkilealrkkikipegcavdkdgkpttdpakalegcilpfggpkgyglalaiemlsaig
    gaevgtkvkgtanpeerctkgdlfiainpeffmgkeefkrkvdelldeiknsepaegfei
    lipgeieernkmkrkdgfeidknlynqlkeicnelglniedyie
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2x06C (C:)
    milkpenekkliidvlkkfgvpeedakitadvfvdadlkgftshgigrfpqyitalklgn
    inpkpdikivkespatavidgdlglgqvvgkkamelaikkaknvgvgvvatrnanhfgia
    gyyselamnqdmigititntepamapfggkekilgtnpiaiafkgnkykfsldmatasia
    rgkilealrkkikipegcavdkdgkpttdpakalegcilpfggpkgyglalaiemlsaig
    gaevgtkvkgtanpeerctkgdlfiainpeffmgkeefkrkvdelldeiknsepaegfei
    lipgeieernkmkrkdgfeidknlynqlkeicnelglniedyie
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2x06D (D:)
    milkpenekkliidvlkkfgvpeedakitadvfvdadlkgftshgigrfpqyitalklgn
    inpkpdikivkespatavidgdlglgqvvgkkamelaikkaknvgvgvvatrnanhfgia
    gyyselamnqdmigititntepamapfggkekilgtnpiaiafkgnkykfsldmatasia
    rgkilealrkkikipegcavdkdgkpttdpakalegcilpfggpkgyglalaiemlsaig
    gaevgtkvkgtanpeerctkgdlfiainpeffmgkeefkrkvdelldeiknsepaegfei
    lipgeieernkmkrkdgfeidknlynqlkeicnelglniedyie
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2x06E (E:)
    milkpenekkliidvlkkfgvpeedakitadvfvdadlkgftshgigrfpqyitalklgn
    inpkpdikivkespatavidgdlglgqvvgkkamelaikkaknvgvgvvatrnanhfgia
    gyyselamnqdmigititntepamapfggkekilgtnpiaiafkgnkykfsldmatasia
    rgkilealrkkikipegcavdkdgkpttdpakalegcilpfggpkgyglalaiemlsaig
    gaevgtkvkgtanpeerctkgdlfiainpeffmgkeefkrkvdelldeiknsepaegfei
    lipgeieernkmkrkdgfeidknlynqlkeicnelglniedyie
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2x06F (F:)
    milkpenekkliidvlkkfgvpeedakitadvfvdadlkgftshgigrfpqyitalklgn
    inpkpdikivkespatavidgdlglgqvvgkkamelaikkaknvgvgvvatrnanhfgia
    gyyselamnqdmigititntepamapfggkekilgtnpiaiafkgnkykfsldmatasia
    rgkilealrkkikipegcavdkdgkpttdpakalegcilpfggpkgyglalaiemlsaig
    gaevgtkvkgtanpeerctkgdlfiainpeffmgkeefkrkvdelldeiknsepaegfei
    lipgeieernkmkrkdgfeidknlynqlkeicnelglniedyie
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2x06G (G:)
    milkpenekkliidvlkkfgvpeedakitadvfvdadlkgftshgigrfpqyitalklgn
    inpkpdikivkespatavidgdlglgqvvgkkamelaikkaknvgvgvvatrnanhfgia
    gyyselamnqdmigititntepamapfggkekilgtnpiaiafkgnkykfsldmatasia
    rgkilealrkkikipegcavdkdgkpttdpakalegcilpfggpkgyglalaiemlsaig
    gaevgtkvkgtanpeerctkgdlfiainpeffmgkeefkrkvdelldeiknsepaegfei
    lipgeieernkmkrkdgfeidknlynqlkeicnelglniedyie
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2x06H (H:)
    milkpenekkliidvlkkfgvpeedakitadvfvdadlkgftshgigrfpqyitalklgn
    inpkpdikivkespatavidgdlglgqvvgkkamelaikkaknvgvgvvatrnanhfgia
    gyyselamnqdmigititntepamapfggkekilgtnpiaiafkgnkykfsldmatasia
    rgkilealrkkikipegcavdkdgkpttdpakalegcilpfggpkgyglalaiemlsaig
    gaevgtkvkgtanpeerctkgdlfiainpeffmgkeefkrkvdelldeiknsepaegfei
    lipgeieernkmkrkdgfeidknlynqlkeicnelglniedyie