Lineage for d2x02b_ (2x02 B:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949750Protein Class D beta-lactamase [56622] (4 species)
  7. 1949760Species Pseudomonas aeruginosa, OXA-10 [TaxId:287] [56623] (27 PDB entries)
  8. 1949762Domain d2x02b_: 2x02 B: [169742]
    automated match to d1k4fb_
    complexed with dms, gol, pg4, so4

Details for d2x02b_

PDB Entry: 2x02 (more details), 1.35 Å

PDB Description: crystal structure of the class d beta-lactamase oxa-10 at 1.35 a resolution
PDB Compounds: (B:) beta-lactamase oxa-10

SCOPe Domain Sequences for d2x02b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x02b_ e.3.1.1 (B:) Class D beta-lactamase {Pseudomonas aeruginosa, OXA-10 [TaxId: 287]}
mgsitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigl
etgviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkk
fsygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaap
eylvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkim
esegiig

SCOPe Domain Coordinates for d2x02b_:

Click to download the PDB-style file with coordinates for d2x02b_.
(The format of our PDB-style files is described here.)

Timeline for d2x02b_: