SCOPe 2.08: Domain d2x02b1: 2x02 B:20-265

Lineage for d2x02b1 (2x02 B:20-265)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein Class D beta-lactamase [56622] (4 species)

7. Species Pseudomonas aeruginosa, OXA-10 [TaxId:287] [56623] (36 PDB entries)

8. Domain d2x02b1: 2x02 B:20-265 [169742]
   Other proteins in same PDB: d2x02b2
   automated match to d1k4fb_
   complexed with dms, gol, pg4, so4

Details for d2x02b1

PDB Entry: 2x02, 1.35 Å

PDB Description: crystal structure of the class d beta-lactamase oxa-10 at 1.35 a resolution

PDB Compounds: (B:) beta-lactamase oxa-10

SCOPe Domain Sequences for d2x02b1:

Sequence; same for both SEQRES and ATOM records:

>d2x02b1 e.3.1.1 (B:20-265) Class D beta-lactamase {Pseudomonas aeruginosa, OXA-10 [TaxId: 287]}
gsitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigle
tgviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkf
sygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaape
ylvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkime
segiig

Timeline for d2x02b1:

• d2x02b1 first appeared in SCOPe 2.01, called d2x02b_
  
• d2x02b1 appears in SCOPe 2.07